DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and se

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:212 Identity:63/212 - (29%)
Similarity:82/212 - (38%) Gaps:38/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLE---DDG- 62
            |.|.||.:...|..:...|.|||..:.|....:||   ..|.:....||||..||.||   :.| 
  Fly    20 GILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINL---TDKPEWLLEKNPQGKVPALEIVREPGP 81

  Fly    63 KFIWESHAICAYLVRRYAKSDDLYPKDYFKRA---LVDQRLHFESGVLFQGCIRNIAIPLFYKNI 124
            ..:.||..||.||..:|... .|||:|..|:.   |:.:|.....|..|:........|.:    
  Fly    82 PVLTESLLICEYLDEQYPLR-PLYPRDPLKKVQDKLLIERFRAVLGAFFKASDGGDLEPFW---- 141

  Fly   125 TEVPRSQIDAIYE---AYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAA-------IDA 179
                 |.:| |||   |....|.|.|.|.       .|.||.:......|..|..       .|.
  Fly   142 -----SGLD-IYERELARRGTEFFGGEQT-------GILDYMIWPWCERLELLKLQRGEDYNYDQ 193

  Fly   180 KRYPKLNGWLDRMAAQP 196
            .|:|:|..||:||...|
  Fly   194 SRFPQLTLWLERMKRDP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 62/210 (30%)
GST_N_Delta_Epsilon 4..76 CDD:239343 26/75 (35%)
GST_C_Delta_Epsilon 92..209 CDD:198287 30/118 (25%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 27/77 (35%)
GstA 22..215 CDD:223698 62/210 (30%)
GST_C_Omega 109..229 CDD:198293 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.