DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GstE8

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:212 Identity:110/212 - (51%)
Similarity:145/212 - (68%) Gaps:0/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65
            |.||:|||.||||||||.||||.|||:.|||..:|.||.|..:.||..||||||||.|||||.||
  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65

  Fly    66 WESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRS 130
            |:||||.||||.:|.:||.|||||..:||:|||||||||||:|...:|.|..|||....|.:|:.
  Fly    66 WDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKE 130

  Fly   131 QIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDRMAAQ 195
            :.||:.|.|||:|.|:....::.|..:||||:|:::|:::|.....||..:|..:..|:.|:...
  Fly   131 RYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEEL 195

  Fly   196 PNYQSLNGNGAQMLIDM 212
            |.|:...|.||:.|:.:
  Fly   196 PYYEEACGKGARDLVTL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 104/196 (53%)
GST_N_Delta_Epsilon 4..76 CDD:239343 50/71 (70%)
GST_C_Delta_Epsilon 92..209 CDD:198287 47/116 (41%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 102/191 (53%)
GST_N_Delta_Epsilon 4..77 CDD:239343 51/72 (71%)
GST_C_Delta_Epsilon 91..209 CDD:198287 47/117 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467961
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.900

Return to query results.
Submit another query.