DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GstE14

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:219 Identity:68/219 - (31%)
Similarity:109/219 - (49%) Gaps:27/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWE 67
            |.:||..|.|||||:|.:.:..|.:..|.|.|||..||...|:|...||||:||.|......:.:
  Fly     5 KPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTD 69

  Fly    68 SHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLF------------QGCIRNIAIPLF 120
            ||||..:|..::.:...|:|:::.:|..|...|.||...||            || ..|:.:...
  Fly    70 SHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQG-FANVDVAHH 133

  Fly   121 YKNITEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKL 185
            .:.:|           |||..:|.::.|..::.||.:|:||.|:|:::|: |.| .....::|:|
  Fly   134 ERKLT-----------EAYIIMERYLENSDFMAGPQLTLADLSIVTTLST-VNL-MFPLSQFPRL 185

  Fly   186 NGWLDRMAAQPNYQSLNGNGAQML 209
            ..|...|.....|:: |.:|.:.|
  Fly   186 RRWFTAMQQLDAYEA-NCSGLEKL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 64/208 (31%)
GST_N_Delta_Epsilon 4..76 CDD:239343 30/71 (42%)
GST_C_Delta_Epsilon 92..209 CDD:198287 33/128 (26%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 64/207 (31%)
GST_N_Delta_Epsilon 6..79 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 94..209 CDD:198287 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.