DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gsto-2

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_871705.3 Gene:gsto-2 / 353420 WormBaseID:WBGene00015337 Length:254 Species:Caenorhabditis elegans


Alignment Length:202 Identity:46/202 - (22%)
Similarity:83/202 - (41%) Gaps:41/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EHKTKEFSLKNPQHTVPVLE-DDG-KFIWESHAICAYLVRRYAKSDDLYPK------DYFKRALV 96
            :.|...|..|:.:..||.|| |:| |.:.||..|..||       ||:||:      |::::  |
 Worm    60 DQKPDWFFTKHYKGQVPALEHDEGKKIVIESAVIPEYL-------DDIYPEPRIIPTDHYEK--V 115

  Fly    97 DQRLHFE--SGVL---FQGCIRNIAIPLFYKNITEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPV 156
            .|:|..:  ||.|   |.|.::       ...|:::.:.::..:.:|||..|..:....|.....
 Worm   116 QQKLLLDRISGQLSSAFYGVVQ-------AAKISDLLKEKLVELAKAYDTAEELLTGDFYSGTSK 173

  Fly   157 ITIADYSVVSSVSSL-----------VGLAAIDAKRYPKLNGWLDRMAAQPNYQSLNGNGAQMLI 210
            ....||.:..::...           :.:.:.....||||:.|..|:.:.|...: .....:..:
 Worm   174 PGFVDYLIYPNIQRAFWTSHIIKDFPLKVESFPGPNYPKLSKWYKRLDSIPEVIA-TSQPTETAV 237

  Fly   211 DMFSSKI 217
            :.|.|.|
 Worm   238 EFFKSWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 43/184 (23%)
GST_N_Delta_Epsilon 4..76 CDD:239343 14/37 (38%)
GST_C_Delta_Epsilon 92..209 CDD:198287 23/132 (17%)
gsto-2NP_871705.3 Thioredoxin_like 8..98 CDD:294274 15/44 (34%)
GstA 29..224 CDD:223698 42/179 (23%)
GST_C_family 112..242 CDD:295467 24/139 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.