DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:259 Identity:54/259 - (20%)
Similarity:82/259 - (31%) Gaps:98/259 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAICAYLVR------ 77
            :|.:...||..|.|.|:|...|||...|...|....|||:......|.:...|..|:.|      
  Rat    65 RLVIAEKGLSCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEH 129

  Fly    78 -----------------RYAKSDDLYPKDYF-----------------KRALVDQRLHFESGVLF 108
                             :|.:..|..|.|.:                 |.|..:.|.|       
  Rat   130 VVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRH------- 187

  Fly   109 QGCIRNIAIPLFYKNITEVPRSQ---------IDAIYEAYD--FLEAFIGNQA------------ 150
               :.|....|...:..|...|:         :..|.|..|  :|:..:|..|            
  Rat   188 ---LANATTDLMKLDHEEPQLSEPYLSKQKKLMAKILEHDDVGYLKKILGELAMVLDQIEAELEK 249

  Fly   151 ------------YLCGPVITIADYSVVSSVSSL--VGLAAIDAKRYPKLNGWLDRMAAQPNYQS 200
                        :|||...|:||..:.:::..|  :||    :|:|     |.|  .::||.||
  Rat   250 RKLENEGQTCELWLCGCAFTLADVLLGATLHRLKFLGL----SKKY-----WED--GSRPNLQS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 54/259 (21%)
GST_N_Delta_Epsilon 4..76 CDD:239343 18/56 (32%)
GST_C_Delta_Epsilon 92..209 CDD:198287 31/146 (21%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 18/56 (32%)
GST_C_family 203..313 CDD:413470 24/111 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.