DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Clic4

DIOPT Version :10

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:179 Identity:30/179 - (16%)
Similarity:59/179 - (32%) Gaps:68/179 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LVNLLAGEH---------------KTKEF-------------SLKNPQHTVPVLEDDGKFIWESH 69
            |.||..|.|               |.:||             |.|:|:.....::...||     
Mouse    66 LQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKF----- 125

  Fly    70 AICAYLVRRYAKSDDLYPKDYFKR-ALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQID 133
              .||:.....::::...:...|. ..:|:.|             |..:|      .|:..:.::
Mouse   126 --SAYIKNSRPEANEALERGLLKTLQKLDEYL-------------NSPLP------DEIDENSME 169

  Fly   134 AIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY 182
            .|.         ...:.:|.|..:|:||.:::..:.    :..:.||:|
Mouse   170 DIK---------FSTRRFLDGDEMTLADCNLLPKLH----IVKVVAKKY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..199 CDD:440390 30/179 (17%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 8/34 (24%)
O-ClC 17..252 CDD:129941 30/179 (17%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Z0W7 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.