DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and GSTZ1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:208 Identity:57/208 - (27%)
Similarity:94/208 - (45%) Gaps:21/208 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLL--AGEHKTKEFSLKNPQHTVPVLEDDGKF 64
            ||.:||....|......::.|...|:.||...:||:  .|:..:|:|...||...||.|:.||..
Human     5 GKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGIT 69

  Fly    65 IWESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGC--IRNIAIPLFYKNITEV 127
            |.:|.||..|| .....:..|.|:|..|||.|    ...|.::..|.  ::|:::   .|.:.| 
Human    70 IHQSLAIIEYL-EEMRPTPRLLPQDPKKRASV----RMISDLIAGGIQPLQNLSV---LKQVGE- 125

  Fly   128 PRSQI----DAIYEAYDFLEAFIGNQA--YLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLN 186
             ..|:    :||...::.||..:.:.|  |..|..:|:||..:|..|::.... .:|...||.::
Human   126 -EMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERF-KVDLTPYPTIS 188

  Fly   187 GWLDRMAAQPNYQ 199
            ....|:.....:|
Human   189 SINKRLLVLEAFQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 55/206 (27%)
GST_N_Delta_Epsilon 4..76 CDD:239343 24/73 (33%)
GST_C_Delta_Epsilon 92..209 CDD:198287 27/116 (23%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 55/205 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.