DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gst-34

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_741060.2 Gene:gst-34 / 260015 WormBaseID:WBGene00001782 Length:218 Species:Caenorhabditis elegans


Alignment Length:226 Identity:53/226 - (23%)
Similarity:89/226 - (39%) Gaps:57/226 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLVLYGVEA-SPPVRACKLTLDALGLQYE-YRLV--NLLAGEHKTKEFSLKN--PQHTVPVLEDD 61
            ||..:.:.| :.|.|   |.....|:.|| .|:.  :::.|.......:||:  |....|||..|
 Worm     5 KLTYFDIRAFAEPAR---LLFHLGGVPYEDVRMPTDDIVPGIQSDAFLALKDKTPFGRFPVLSID 66

  Fly    62 GKFIWESHAICAYLVRRYAKSDDLYPKDYFKRALVDQ-RLHFESGVLFQGCIRNIAIPLFYKNIT 125
            |..:.:|.||..||.|::..:......:.|..::||| :.:.||   |:        ||.|...:
 Worm    67 GFDLAQSTAIHRYLARKFGYAGKSPEDEAFADSIVDQVKEYLES---FR--------PLLYAQKS 120

  Fly   126 EVPRSQIDAIYEAYDFLEAFI----------------GNQAYLCGPVITIADYSVVSSVSSLVGL 174
            ..|..::..|::     |.:|                ....||.|..:|.||..|...:.||..:
 Worm   121 GKPEEEVKRIHD-----EVYIPVKNLLFKILTRILKESKSEYLVGDGLTWADLVVADHLYSLTNI 180

  Fly   175 AAID--------AKRY-------PKLNGWLD 190
            ..:|        .|:|       |:|..:::
 Worm   181 KELDPEDPIHLNLKKYQERIFNLPELKDYIE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 52/225 (23%)
GST_N_Delta_Epsilon 4..76 CDD:239343 22/77 (29%)
GST_C_Delta_Epsilon 92..209 CDD:198287 27/131 (21%)
gst-34NP_741060.2 GST_N_Sigma_like 4..82 CDD:239337 24/79 (30%)
PTZ00057 6..213 CDD:173353 52/225 (23%)
GST_C_Sigma_like 92..200 CDD:198301 26/123 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.