DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gst2

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:224 Identity:67/224 - (29%)
Similarity:88/224 - (39%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLED---DG 62
            |....||.....|......|.|..|.|.||....:...||.|.||....||...||.|.|   :.
pombe     1 MAHFTLYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNND 65

  Fly    63 KFIWESHAICAYLVRRY-------AKSDDLYPKDYFKRALVDQRLHFE-SGVLFQGCIRNIA--I 117
            ..||||.||..||..:|       ...||   .:|:|   :.|.|.|: ||   ||.|...|  .
pombe    66 YTIWESDAILIYLADKYDTDRKISLSFDD---PEYYK---LIQYLFFQASG---QGVIWGQAGWF 121

  Fly   118 PLFYKN--ITEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGL------ 174
            ..|:..  ::.|.|.: :.|......||..:.::.||.....||||.|.:....:|.||      
pombe   122 NFFHHEPVVSAVTRYR-NEIKRVLGVLEDILKDRDYLVANKYTIADLSFIPWNYNLGGLFGEGKF 185

  Fly   175 ------AAID-AKRYPKLNGWLDRMAAQP 196
                  ..:| .|.:||...|..|:.|:|
pombe   186 SFKEEVPQLDFEKEFPKAYAWNQRLLARP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 66/221 (30%)
GST_N_Delta_Epsilon 4..76 CDD:239343 27/74 (36%)
GST_C_Delta_Epsilon 92..209 CDD:198287 34/123 (28%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 29/79 (37%)
GstA 5..226 CDD:223698 66/220 (30%)
GST_C_Ure2p 96..219 CDD:198326 35/126 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.