DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Gstt1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_445745.1 Gene:Gstt1 / 25260 RGDID:2765 Length:240 Species:Rattus norvegicus


Alignment Length:200 Identity:55/200 - (27%)
Similarity:91/200 - (45%) Gaps:11/200 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWES 68
            |.||....|.|.||..:......:.::...|.|..|||.:..|:..||...||.::|.|..:.||
  Rat     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCES 67

  Fly    69 HAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIR----NIAIPLFY-----KNI 124
            .||..||..:|...|..||:|...||.||:.|.::...|.:.|:|    .:..|:|.     ..:
  Rat    68 VAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMFPVFLGEQIRPEM 132

  Fly   125 TEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWL 189
            .....:.:|...:..:  :.|:.::.:|.||.|::||...::.:...||......:..|:|..|.
  Rat   133 LAATLADLDVNVQVLE--DQFLQDKDFLVGPHISLADVVAITELMHPVGGGCPVFEGRPRLAAWY 195

  Fly   190 DRMAA 194
            .|:.|
  Rat   196 RRVEA 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 54/199 (27%)
GST_N_Delta_Epsilon 4..76 CDD:239343 24/71 (34%)
GST_C_Delta_Epsilon 92..209 CDD:198287 24/111 (22%)
Gstt1NP_445745.1 GST_N_Theta 3..78 CDD:239348 25/74 (34%)