DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and AIMP3

DIOPT Version :10

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:54 Identity:19/54 - (35%)
Similarity:32/54 - (59%) Gaps:2/54 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DFLEAFIGNQAYLCGPVITIADYSVVSSVSSLV-GLAAIDAKRYPKLNGWLDRM 192
            ||.:.| .:::||.|..||:||.:|..::..|| .|:.:|.:.|..|:.|.|.:
  Fly    98 DFNKLF-ASKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..199 CDD:440390 19/54 (35%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 19/54 (35%)

Return to query results.
Submit another query.