DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_659140.2 Gene:Gdap1l1 / 228858 MGIID:2385163 Length:367 Species:Mus musculus


Alignment Length:277 Identity:58/277 - (20%)
Similarity:87/277 - (31%) Gaps:103/277 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWES 68
            ||||....|...:..:|.:...||..|.|.|:|...|||...|...|....|||:......|.:.
Mouse    47 LVLYHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDY 111

  Fly    69 HAICAYLVR-----------------------RYAKSDDLYPKDYF-----------------KR 93
            ..|..|:.|                       :|.:..|..|.|.:                 |.
Mouse   112 DQIIDYVERTFTGEHVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKY 176

  Fly    94 ALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQIDAIY--------------EAYDFLEA 144
            |..:.|.|          :.|....|...:..|.|  |:...|              :...:|:.
Mouse   177 ATAEIRRH----------LANATTDLMKLDHEEEP--QLSEPYLSKQKKLMAKILEHDDVSYLKK 229

  Fly   145 FIGNQA------------------------YLCGPVITIADYSVVSSVSSL--VGLAAIDAKRYP 183
            .:|..|                        :|||...|:||..:.:::..|  :||    :|:| 
Mouse   230 ILGELAMVLDQIEAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRLKFLGL----SKKY- 289

  Fly   184 KLNGWLDRMAAQPNYQS 200
                |.|  .::||.||
Mouse   290 ----WED--GSRPNLQS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 58/277 (21%)
GST_N_Delta_Epsilon 4..76 CDD:239343 23/71 (32%)
GST_C_Delta_Epsilon 92..209 CDD:198287 30/149 (20%)
Gdap1l1NP_659140.2 GstA 47..314 CDD:223698 58/277 (21%)
GST_N_GDAP1 47..119 CDD:239350 23/71 (32%)
GST_C_family 201..311 CDD:295467 23/113 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.