DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Clic6

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_766057.1 Gene:Clic6 / 209195 MGIID:2146607 Length:596 Species:Mus musculus


Alignment Length:178 Identity:37/178 - (20%)
Similarity:66/178 - (37%) Gaps:51/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LVNLLAGEHKTKEFSLKN--PQHTVPVLEDDGKFIWESHAICAYLVR-----RYAKSDDLYPK-- 88
            :.|:...:.|.|...|:|  |....|.:..||:...:.:.|..:|..     ||.|....:|:  
Mouse   395 IFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHPESN 459

  Fly    89 ----DYFKRALVDQRLHFESGVLFQGCIRNI---AIPLFYKNITEVPR-----------SQIDAI 135
                |.|.:              |...|:|.   |..::.||:....:           .:||| 
Mouse   460 SAGNDVFAK--------------FSAFIKNTKKDANEIYEKNLLRALKKLDSYLNSPLPDEIDA- 509

  Fly   136 YEAYDFLE-AFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY 182
                |..| ..:..:.:|.|..:|:||.:::..:.    :..|.||:|
Mouse   510 ----DSSEDVTVSQRKFLDGDELTLADCNLLPKLH----IIKIVAKKY 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 37/178 (21%)
GST_N_Delta_Epsilon 4..76 CDD:239343 10/44 (23%)
GST_C_Delta_Epsilon 92..209 CDD:198287 20/106 (19%)
Clic6NP_766057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..360
PHA02664 <69..167 CDD:177447
GST_N_CLIC 360..448 CDD:239359 11/52 (21%)
O-ClC 363..596 CDD:129941 37/178 (21%)
GST_C_CLIC6 455..594 CDD:198334 23/118 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.