| Sequence 1: | NP_725784.1 | Gene: | GstE9 / 246581 | FlyBaseID: | FBgn0063491 | Length: | 221 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001395.1 | Gene: | EEF1G / 1937 | HGNCID: | 3213 | Length: | 437 | Species: | Homo sapiens |
| Alignment Length: | 203 | Identity: | 53/203 - (26%) |
|---|---|---|---|
| Similarity: | 86/203 - (42%) | Gaps: | 26/203 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 16 RACKLTLDALGLQYEYRLVNLLAG--------EHKTKEFSLKNPQHTVPVLE-DDGKFIWESHAI 71
Fly 72 CAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGC----IRNIAIPLFYKNITEVPRSQI 132
Fly 133 DAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVG--LAAIDAKRYPKLNGWLDRMAAQ 195
Fly 196 PNYQSLNG 203 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstE9 | NP_725784.1 | GstA | 4..201 | CDD:223698 | 52/199 (26%) |
| GST_N_Delta_Epsilon | 4..76 | CDD:239343 | 25/68 (37%) | ||
| GST_C_Delta_Epsilon | 92..209 | CDD:198287 | 26/118 (22%) | ||
| EEF1G | NP_001395.1 | GST_N_EF1Bgamma | 4..82 | CDD:239342 | 26/75 (35%) |
| GST_C_EF1Bgamma_like | 91..213 | CDD:198290 | 26/118 (22%) | ||
| tolA | <212..>278 | CDD:236545 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 221..268 | ||||
| EF1G | 277..381 | CDD:395522 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||