DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gst-21

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001256002.1 Gene:gst-21 / 191412 WormBaseID:WBGene00001769 Length:231 Species:Caenorhabditis elegans


Alignment Length:234 Identity:52/234 - (22%)
Similarity:82/234 - (35%) Gaps:79/234 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KLT-LDALGLQYEYRLVNLLAG----------EHKT--------KEFSLKNPQHTVPVLEDDGKF 64
            ||| .|..||....|::..|.|          :.||        .:...|.|....|||:.|...
 Worm    17 KLTYFDGRGLAEPARMLFHLGGVPFEDSRIPVDMKTGLIMNPELADVKKKAPFGKYPVLKIDDIE 81

  Fly    65 IWESHAICAYLVRRY----------AKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPL 119
            |.:|.||..||.|::          |::|          :.:||...:.:.  |:.|:       
 Worm    82 IAQSAAINRYLARQFGFAGKNPIEEAQAD----------SYIDQCQEYNTS--FRACM------- 127

  Fly   120 FYKNITEVPRSQIDAIYEAY------DFLEAFI-----GNQAYLCGPVITIADYSVVSSVSSLVG 173
             |..:...|..::..|.|..      .|.|.|.     ....:|.|..:|.||..:...:.||..
 Worm   128 -YATLQGKPEEEVQKIREEVYIPAQNKFYEIFSDILNRNKSGFLVGDSLTWADLVIADHLYSLDT 191

  Fly   174 LAAI---DAKR-------------YPKLNGWLDRMAAQP 196
            :..:   ||.|             :|.|.|::   |::|
 Worm   192 MGMLTHEDAWRCETLKKFQEKIYEHPLLKGYI---ASRP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 52/234 (22%)
GST_N_Delta_Epsilon 4..76 CDD:239343 22/75 (29%)
GST_C_Delta_Epsilon 92..209 CDD:198287 26/132 (20%)
gst-21NP_001256002.1 GST_N_Sigma_like 16..94 CDD:239337 23/76 (30%)
PTZ00057 18..231 CDD:173353 51/233 (22%)
GST_C_Sigma_like 104..213 CDD:198301 23/128 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.