DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gst-43

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:204 Identity:52/204 - (25%)
Similarity:82/204 - (40%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTK-EFSLKNPQHTVPVLEDDGKF 64
            |.|.:||....|......::.|....:.||||.::|.:.|.|.. ||...||...||.|..:|..
 Worm     1 MAKPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLS 65

  Fly    65 IWESHAICAYLVRRYAKSDDLYPKDYFKRALVDQR-------LHFESGVLFQGCIRNIAIPL--- 119
            :.||.||..||       |:.||...|....:|:|       ||..:.:.          ||   
 Worm    66 LTESLAIIEYL-------DEAYPDPPFLPKELDKRSYSRAIALHIVASIQ----------PLQAI 113

  Fly   120 -FYKNITEVPRSQID-----AIYEAYDFLEAFIGNQA--YLCGPVITIADYSVVSSVSSLVGLAA 176
             .:|.:.|......|     .:.:.:..||..:...:  |..|..:||||.::.|.:.: ..:..
 Worm   114 NIHKMLNEKEPGYGDFWCNHFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYN-AKIYK 177

  Fly   177 IDAKRYPKL 185
            :|..:||.:
 Worm   178 VDMSKYPTI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 50/201 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 92..209 CDD:198287 21/112 (19%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 25/79 (32%)
maiA 5..211 CDD:273527 50/200 (25%)
GST_C_Zeta 90..207 CDD:198300 21/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163448
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.