Sequence 1: | NP_725784.1 | Gene: | GstE9 / 246581 | FlyBaseID: | FBgn0063491 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491070.1 | Gene: | gst-43 / 190586 | WormBaseID: | WBGene00001791 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 52/204 - (25%) |
---|---|---|---|
Similarity: | 82/204 - (40%) | Gaps: | 37/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTK-EFSLKNPQHTVPVLEDDGKF 64
Fly 65 IWESHAICAYLVRRYAKSDDLYPKDYFKRALVDQR-------LHFESGVLFQGCIRNIAIPL--- 119
Fly 120 -FYKNITEVPRSQID-----AIYEAYDFLEAFIGNQA--YLCGPVITIADYSVVSSVSSLVGLAA 176
Fly 177 IDAKRYPKL 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE9 | NP_725784.1 | GstA | 4..201 | CDD:223698 | 50/201 (25%) |
GST_N_Delta_Epsilon | 4..76 | CDD:239343 | 24/72 (33%) | ||
GST_C_Delta_Epsilon | 92..209 | CDD:198287 | 21/112 (19%) | ||
gst-43 | NP_491070.1 | GST_N_Zeta | 4..77 | CDD:239340 | 25/79 (32%) |
maiA | 5..211 | CDD:273527 | 50/200 (25%) | ||
GST_C_Zeta | 90..207 | CDD:198300 | 21/108 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160163448 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |