DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:230 Identity:58/230 - (25%)
Similarity:88/230 - (38%) Gaps:56/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWE 67
            |.:||...:|......:..|....:.|||:.|||| .:.|.:||...||...||:|:.:|..:.|
 Worm     4 KPILYSSWSSGCSSRVRTALALKKIDYEYQPVNLL-NKQKEQEFHGNNPAEKVPILKINGLTLTE 67

  Fly    68 SHAICAYLVRRYAKSDDLYPKDYF----------KRALVDQRLHFESGVLFQGCIRNIAIPL--- 119
            |.||..||       |::||....          .||:.   .|..|.:.          ||   
 Worm    68 SMAIIEYL-------DEIYPDPPLLPKEPELKARARAIA---FHIASNIQ----------PLQNK 112

  Fly   120 -FYKNITEVPRSQID-----AIYEAYDFLEAF---------IGNQAYLCGPVITIADYSVVSSVS 169
             .|..:.|......|     .|.:.:..||..         :|||       |:|||..:.|.|.
 Worm   113 PIYLMLNEKEPGYGDFWCQHFISKGFKALEELLQMHSGDFCVGNQ-------ISIADICLPSIVY 170

  Fly   170 SLVGLAAIDAKRYPKLNGWLDRMAAQPNYQSLNGN 204
            :.:....:|...||.:....:::|..|.:|..:.|
 Worm   171 NAIEKYHVDMTPYPIITRISNKLAELPEFQVAHPN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 56/224 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 25/71 (35%)
GST_C_Delta_Epsilon 92..209 CDD:198287 28/131 (21%)
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 26/78 (33%)
maiA 18..211 CDD:273527 54/216 (25%)
GST_C_Zeta 89..207 CDD:198300 28/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163435
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.