DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gst-32

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_497123.2 Gene:gst-32 / 190230 WormBaseID:WBGene00001780 Length:209 Species:Caenorhabditis elegans


Alignment Length:186 Identity:42/186 - (22%)
Similarity:70/186 - (37%) Gaps:17/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KLTLDALGLQYE-YRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAICAYLVRRYAKS 82
            ::.....|:.:| :|...   |....::...|.|...||||..||..|.:|.||..||..::..:
 Worm    19 RILFQLAGVPFEDFRFTR---GNGTWEKLKDKTPFGQVPVLTVDGFDIPQSSAIIRYLANKFGYA 80

  Fly    83 DDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAI-PLFYKNITEVPRSQIDAIYEAYDFLEAFI 146
            .....:..:..|:.||...|...      .:.|.| ....|...|:.:...:....|.|.....|
 Worm    81 GKTPEEQAWADAICDQVKDFIDS------FKQIVIAKRDGKTAEEIEKIHTEIFLPAKDSYFKII 139

  Fly   147 ------GNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDRMAAQP 196
                  ....:|.|..:|.||..||.:.::|......:|...|:|....:::.|.|
 Worm   140 NGILEKSKSGFLVGDSLTFADIVVVENFTTLDKNHYCNASEQPRLTALREKVYAIP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 42/186 (23%)
GST_N_Delta_Epsilon 4..76 CDD:239343 17/57 (30%)
GST_C_Delta_Epsilon 92..209 CDD:198287 24/112 (21%)
gst-32NP_497123.2 GST_N_Sigma_like 4..74 CDD:239337 17/57 (30%)
PTZ00057 6..208 CDD:173353 42/186 (23%)
GST_C_Sigma_like 85..191 CDD:198301 22/111 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.