DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gst-24

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_496859.1 Gene:gst-24 / 185407 WormBaseID:WBGene00001772 Length:209 Species:Caenorhabditis elegans


Alignment Length:184 Identity:42/184 - (22%)
Similarity:72/184 - (39%) Gaps:20/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLVLYGVE--ASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65
            ||..:.:.  |.|..:..||.      ..|:..|.:..|..:......|.|...:|.|..||..|
 Worm     5 KLYYFNLRGWAEPARQLFKLA------HVEFEDVRIENGTPEWGALKPKTPFGQLPFLSVDGFEI 63

  Fly    66 WESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRS 130
            .:|.||..||.:::..:.....::.:..|:|||...|.:.      :|.:.:.....|..|:.|.
 Worm    64 PQSAAILRYLAKKFGYAGKTSEEEAWVDAIVDQFKDFVTP------LRQLIMAQRSGNAEEIERI 122

  Fly   131 QIDAIYEAYD-FLEAFIG-----NQAYLCGPVITIADYSVVSSVSSLVGLAAID 178
            |.:....|.| |.:...|     ...:|.|..:|.||..:...::::..|...|
 Worm   123 QKEVFAPARDTFFKILNGILEKSKSGFLVGDGVTWADLVIADILTTMEMLGVFD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 41/183 (22%)
GST_N_Delta_Epsilon 4..76 CDD:239343 19/73 (26%)
GST_C_Delta_Epsilon 92..209 CDD:198287 21/93 (23%)
gst-24NP_496859.1 GST_N_Sigma_like 4..75 CDD:239337 21/75 (28%)
PTZ00057 6..208 CDD:173353 41/183 (22%)
GST_C_Sigma_like 85..191 CDD:198301 21/98 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.