DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and eef-1G

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_505800.1 Gene:eef-1G / 179522 WormBaseID:WBGene00008920 Length:398 Species:Caenorhabditis elegans


Alignment Length:241 Identity:50/241 - (20%)
Similarity:90/241 - (37%) Gaps:58/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVN---LLAGEHKTKEFSLKNPQHTVPVLEDDGK 63
            ||  |||.:.:  .|..|:.:.|       :|.|   .|||:....:   |.|....|..|.|. 
 Worm     3 GK--LYGNKDN--FRTQKVLIAA-------KLANKTVTLAGDAAPAD---KFPLGVTPAFEGDA- 52

  Fly    64 FIWESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQG----CIRNIAIPLFYKNI 124
            .::.:.:|..:|....|.::.:            |.|.|..|.|...    .:.:::...|.|..
 Worm    53 LLFGAESIGLHLTGTSANAETV------------QWLQFAEGYLLPAVLGYVLPSVSAANFDKKT 105

  Fly   125 TEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAA----IDA---KRY 182
            .|..:::::...:.   |:..:..:.||.|..:::||.||...:     |.|    :||   |..
 Worm   106 VEQYKNELNGQLQV---LDRVLVKKTYLVGERLSLADVSVALDL-----LPAFQYVLDANARKSI 162

  Fly   183 PKLNGWLDRMAAQPNYQSLNGNGA---------QMLIDMFSSKITK 219
            ..:..|...:..||..:.:.|..:         |......|:|:.|
 Worm   163 VNVTRWFRTVVNQPAVKEVLGEVSLASSVAQFNQAKFTELSAKVAK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 43/210 (20%)
GST_N_Delta_Epsilon 4..76 CDD:239343 17/74 (23%)
GST_C_Delta_Epsilon 92..209 CDD:198287 26/136 (19%)
eef-1GNP_505800.1 GST_N_EF1Bgamma 3..77 CDD:239342 22/100 (22%)
GstA 4..181 CDD:223698 44/211 (21%)
GST_C_EF1Bgamma_like 71..188 CDD:198290 25/136 (18%)
EF1G 238..343 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.