DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gsto-3

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_741069.1 Gene:gsto-3 / 175196 WormBaseID:WBGene00019636 Length:309 Species:Caenorhabditis elegans


Alignment Length:220 Identity:53/220 - (24%)
Similarity:87/220 - (39%) Gaps:52/220 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIW 66
            |...||.:...|..:...:.|....:..|...||   .:.....:..|:|...||.||.:||.:|
 Worm    97 GNYRLYSMRFCPYAQRVLIYLAKKNIPVEVVNVN---PDRSPNWYLPKSPIGRVPALEINGKVVW 158

  Fly    67 ESHAICAYLVRRYAKSDDLY------PKDYFKRA---LVDQRLHFESGVLFQGCIRNIAIPLFYK 122
            ||:.|..||       |:|:      |:|.:::|   ::.:||......||:          ||.
 Worm   159 ESNVIVEYL-------DELFPTNTILPRDAYEKAHQKILVERLSPIMNALFE----------FYG 206

  Fly   123 NITEVPRSQ-------IDAIYEAYDFL-EAFIGNQA-----YLCGPV---ITIADYSVVSSVSSL 171
            : :..|::|       ..|:..:.:.| :.|.|.:.     ||..|.   :.:...|..|.....
 Worm   207 S-SNNPQAQRQNDMNVHSALRNSENLLRDTFYGGRQPGYADYLMWPFLERLQLLTMSPNSQFRYF 270

  Fly   172 VGLAAIDAKRYPKLNGWLDRMAAQP 196
            .||      .|||:..::.||..||
 Worm   271 PGL------HYPKIGAYIARMQNQP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 52/218 (24%)
GST_N_Delta_Epsilon 4..76 CDD:239343 20/71 (28%)
GST_C_Delta_Epsilon 92..209 CDD:198287 27/124 (22%)
gsto-3NP_741069.1 GST_N_Omega 81..168 CDD:239353 22/80 (28%)
GST_C_Omega 182..308 CDD:198293 27/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.