DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and exl-1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_497000.1 Gene:exl-1 / 175100 WormBaseID:WBGene00001371 Length:238 Species:Caenorhabditis elegans


Alignment Length:107 Identity:22/107 - (20%)
Similarity:40/107 - (37%) Gaps:25/107 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EHKTKEFSLK--------NPQHTVPVLEDDGKFI-------WESHAICAYLVRRYAKSDDL-YPK 88
            ||:...|:.:        :.|.|..::.||...|       ..|..:.|.:::.|....|| :..
 Worm   120 EHRDTAFNTELLRLDKYLSEQETKFLISDDVTHIDCLVLTRLHSIRVAAKMLKNYEIPADLSHVL 184

  Fly    89 DYFKRALVDQRLHFESGVLFQ-GCIRNIAIPLFYKNITEVPR 129
            ||.|.....:        :|: .|..:..|.|.:..:.:.||
 Worm   185 DYLKAGYATE--------MFRVSCPSDQEIVLHWTELKDTPR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 22/107 (21%)
GST_N_Delta_Epsilon 4..76 CDD:239343 10/50 (20%)
GST_C_Delta_Epsilon 92..209 CDD:198287 7/39 (18%)
exl-1NP_497000.1 O-ClC 2..213 CDD:129941 20/100 (20%)
GST_C_family 98..210 CDD:295467 20/97 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.