DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Gstz1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:195 Identity:54/195 - (27%)
Similarity:90/195 - (46%) Gaps:21/195 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLL--AGEHKTKEFSLKNPQHTVPVLEDDGKF 64
            ||.:||....|......::.|...|:.||...:||:  .|:..|:||...||...||.|:.||..
Mouse     4 GKPILYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGIT 68

  Fly    65 IWESHAICAYL--VRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGC--IRNIAIPLFYKNIT 125
            |.:|.||..||  .|...:   |.|:|..|||:|    ...|.::..|.  ::|:::   .|.:.
Mouse    69 IVQSLAIMEYLEETRPIPR---LLPQDPQKRAIV----RMISDLIASGIQPLQNLSV---LKQVG 123

  Fly   126 EVPRSQ--IDAIYEAYDFLEAFIGNQA--YLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLN 186
            :..:.|  ...|...::.||..:.:.|  |..|..:::||..:|..|::.... .:|...||.::
Mouse   124 QENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERF-KVDLSPYPTIS 187

  Fly   187  186
            Mouse   188  187

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 52/193 (27%)
GST_N_Delta_Epsilon 4..76 CDD:239343 26/75 (35%)
GST_C_Delta_Epsilon 92..209 CDD:198287 22/101 (22%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 25/73 (34%)
maiA 7..211 CDD:273527 52/192 (27%)
Glutathione binding 14..19 1/4 (25%)