DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and Gsto1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:203 Identity:55/203 - (27%)
Similarity:89/203 - (43%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLED-DGKFI 65
            |::.:|.:...|..:...:.|.|.|:::|...:||   ::|.:.|..|||...|||||: .|..:
Mouse    22 GQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININL---KNKPEWFFEKNPLGLVPVLENSQGHLV 83

  Fly    66 WESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYK------NI 124
            .||...|.||...|.:. .|:|.|.:|:|  .|::..||   |......||..:..|      |:
Mouse    84 TESVITCEYLDEAYPEK-KLFPDDPYKKA--RQKMTLES---FSKVPPLIASFVRSKRKEDSPNL 142

  Fly   125 TEVPRSQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY-PKLNGW 188
            .|...::...:.|..|..::|:|      |...::.||........|..|...:...: |||..|
Mouse   143 REALENEFKKLEEGMDNYKSFLG------GDSPSMVDYLTWPWFQRLEALELKECLAHTPKLKLW 201

  Fly   189 LDRMAAQP 196
            :..|...|
Mouse   202 MAAMQQDP 209

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 54/201 (27%)
GST_N_Delta_Epsilon 4..76 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 92..209 CDD:198287 26/112 (23%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 24/74 (32%)
GstA 26..224 CDD:223698 54/199 (27%)