Sequence 1: | NP_725784.1 | Gene: | GstE9 / 246581 | FlyBaseID: | FBgn0063491 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034397.1 | Gene: | Gdap1 / 14545 | MGIID: | 1338002 | Length: | 358 | Species: | Mus musculus |
Alignment Length: | 293 | Identity: | 59/293 - (20%) |
---|---|---|---|
Similarity: | 91/293 - (31%) | Gaps: | 103/293 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWES 68
Fly 69 HAICAYLVRRYA----------KSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKN 123
Fly 124 ITEVPRSQIDAIYEAY------------------------DFLEAFI------------------ 146
Fly 147 -----------------------------GNQAYLCGPVITIADYSVVSSVSSL--VGLAAID-- 178
Fly 179 -AKRYPKLNGWLDRMAAQPNYQSLNGNGAQMLI 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE9 | NP_725784.1 | GstA | 4..201 | CDD:223698 | 56/282 (20%) |
GST_N_Delta_Epsilon | 4..76 | CDD:239343 | 21/71 (30%) | ||
GST_C_Delta_Epsilon | 92..209 | CDD:198287 | 33/192 (17%) | ||
Gdap1 | NP_034397.1 | GST_N_GDAP1 | 26..98 | CDD:239350 | 21/71 (30%) |
GST_C_GDAP1 | 179..289 | CDD:198336 | 22/110 (20%) | ||
Required for mitochondrial localization. /evidence=ECO:0000250 | 320..358 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844848 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |