DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and CLIC2

DIOPT Version :10

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:117 Identity:25/117 - (21%)
Similarity:49/117 - (41%) Gaps:25/117 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 YLVRRYAKSDD----LYPK--DYFKRALVDQRLHFESGVL--FQGCIRNIAIPLFYKNITEVPRS 130
            :|..:|.:|.|    |:.|  .|.|....:...:||..:|  |:.....:..||    :.|:...
Human   101 HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPL----LDEIDPD 161

  Fly   131 QIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRY 182
            ..:         |..:..:.:|.|..:|:||.|::..::    :..:.||:|
Human   162 SAE---------EPPVSRRLFLDGDQLTLADCSLLPKLN----IIKVAAKKY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..199 CDD:440390 25/117 (21%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96
N-terminal 1..94
O-ClC 12..245 CDD:129941 25/117 (21%)
G-site. /evidence=ECO:0000305|PubMed:25581026 30..33
Joint loop 95..106 1/4 (25%)
C-terminal 107..247 23/111 (21%)
Foot loop 151..171 4/32 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.