DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and CLIC1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001274522.1 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens


Alignment Length:171 Identity:36/171 - (21%)
Similarity:57/171 - (33%) Gaps:42/171 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKL--VLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKF 64
            |:|  :|||.|........:..|:|:.....|            .:.:..||:.....|:...||
Human    62 GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRY------------PKLAALNPESNTAGLDIFAKF 114

  Fly    65 IWESHAICAYLVRRYAKSDDLYPKDYFKRAL--------------VDQRLHFESGVLFQGCIRNI 115
                   .||:.......:|...|...| ||              ||:....:.||..:..:...
Human   115 -------SAYIKNSNPALNDNLEKGLLK-ALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGN 171

  Fly   116 AIPLFYKNITEVPRSQIDAI----YEAYDFLEAFIGNQAYL 152
            .:.|...|:  :|:..|..:    |..:...|||.|...||
Human   172 ELTLADCNL--LPKLHIVQVVCKKYRGFTIPEAFRGVHRYL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 35/169 (21%)
GST_N_Delta_Epsilon 4..76 CDD:239343 15/73 (21%)
GST_C_Delta_Epsilon 92..209 CDD:198287 18/79 (23%)
CLIC1NP_001274522.1 Required for insertion into the membrane 2..90 8/27 (30%)
O-ClC 6..241 CDD:129941 36/171 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.