DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and gstz1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:199 Identity:54/199 - (27%)
Similarity:91/199 - (45%) Gaps:26/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLL--AGEHKTKEFSLKNPQHTVPVLEDDGK 63
            :||.:|||...|......::.|...|::|:.:::||:  .|...:.|:...||...||.|..||.
 Frog     4 LGKPLLYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGV 68

  Fly    64 FIWESHAICAYLVRRYAKSDDLYPKDYFKRALV----DQRLHFESGVLFQGCIRNIAIPLFYKNI 124
            .:.:|.||..|| .....:..|.|:|..|||.|    ||   ..||:   ..::|:.:      :
 Frog    69 TLSQSLAIIEYL-EETRPNPPLLPRDPKKRAQVRMISDQ---IASGI---QPLQNLCV------L 120

  Fly   125 TEVPRSQID----AIYEAYDFLEAFIGNQA--YLCGPVITIADYSVVSSVSSLVGLAAIDAKRYP 183
            .::..::::    .|...:..||..:...|  |..|..:||||..:|..|::.|.. .:|...||
 Frog   121 QKIGETKLEWAKHFITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVANAVRF-KVDLAPYP 184

  Fly   184 KLNG 187
            .:.|
 Frog   185 TIVG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 52/196 (27%)
GST_N_Delta_Epsilon 4..76 CDD:239343 22/73 (30%)
GST_C_Delta_Epsilon 92..209 CDD:198287 26/106 (25%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 52/195 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.