DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE9 and eef1e1

DIOPT Version :9

Sequence 1:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001107137.1 Gene:eef1e1 / 100038230 XenbaseID:XB-GENE-493638 Length:174 Species:Xenopus tropicalis


Alignment Length:145 Identity:28/145 - (19%)
Similarity:63/145 - (43%) Gaps:24/145 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VPVLE-DDGKFIWESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIP 118
            :|||: :.|..:.....|.::||:. ||.::|......::|:|.|.|.:                
 Frog    30 IPVLQTNKGPSLVGLSTIASHLVKE-AKKEELLGSTAEEKAIVQQWLEY---------------- 77

  Fly   119 LFYKNITEVPR-SQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLV-GLAAIDAKR 181
                .|:.:.| |..:.|....:.|..::.::.::.|..:|:||..:...:..:: ||:..:.:.
 Frog    78 ----RISYIDRASSKEDIRNVLNDLNHYLKDKVFVAGNTVTLADILIYYGLHPVITGLSVQEKET 138

  Fly   182 YPKLNGWLDRMAAQP 196
            |..::.|...:...|
 Frog   139 YINVSRWFSHIQNYP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE9NP_725784.1 GstA 4..201 CDD:223698 28/145 (19%)
GST_N_Delta_Epsilon 4..76 CDD:239343 5/21 (24%)
GST_C_Delta_Epsilon 92..209 CDD:198287 18/107 (17%)
eef1e1NP_001107137.1 GST_C_AIMP3 65..165 CDD:198338 18/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.