DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-X and PBN1

DIOPT Version :9

Sequence 1:NP_001286172.1 Gene:PIG-X / 246580 FlyBaseID:FBgn0050381 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_009878.1 Gene:PBN1 / 850305 SGDID:S000000557 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:36/186 - (19%)
Similarity:59/186 - (31%) Gaps:48/186 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CEYALVQDLPASVYISTDEL--------DDLQRLKRLNAIYPKFVNIEVATERAQPFSVLLRGTP 87
            |.|.:...||..::|...:.        |||:        .|::...:.|......|.:......
Yeast   245 CMYLMHLQLPLELFIDKFQSSPLLLFGEDDLE--------LPEYSLRDKAWGSESIFELKAGTMN 301

  Fly    88 KITESLALPVHFRYHAPSDKRLAATVAIPLPELYLNCPMADSALIENELVARPDKLYCLNAPESR 152
            ::|      :|.||..||:.:.........||:.|.|...|:.:..|....:.      ...||.
Yeast   302 EVT------LHTRYIEPSNNKGDKLEVSFDPEVILACDTGDNKVSRNPFYKKG------LGYESL 354

  Fly   153 FDENHIKDGQPTTMANLERCNWRRVHVDCQLKMPLRAEIPVGHASAYGPVLCGTIL 208
            |.::       ||..:|.             ...|...||......|..:..||:|
Yeast   355 FTDD-------TTFRHLN-------------STTLLVPIPRPDTKDYSKIKNGTLL 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-XNP_001286172.1 PIG-X 3..218 CDD:285514 36/186 (19%)
PBN1NP_009878.1 PIG-X 224..406 CDD:197872 36/186 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R890
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.