DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-X and Pigx

DIOPT Version :9

Sequence 1:NP_001286172.1 Gene:PIG-X / 246580 FlyBaseID:FBgn0050381 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_077784.2 Gene:Pigx / 72084 MGIID:1919334 Length:254 Species:Mus musculus


Alignment Length:240 Identity:54/240 - (22%)
Similarity:90/240 - (37%) Gaps:60/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAGMHSDKCLCRTLNYRLRF-----DIPLVGKDCEYALVQDLPASVYISTDELDDLQRLKRLNAI 62
            |.|.|.|      |..:::|     |:    :.|...:...:|..:::...||..|:......|:
Mouse    50 KDGFHRD------LLIKVKFGESIEDL----QTCRLLIKHYIPPGLFVDPYELASLRERNLTEAV 104

  Fly    63 -YPKFVNIEVATERAQPFSVLL--RGTPKITESLA--LPVHFRYHAPSDKRLAATVAIPLPELYL 122
             ..:..|||.....:...:||:  |...:..:...  ||||:|||.|..|.....:.:..|:|.:
Mouse   105 MLSESFNIEAPNYLSNESAVLIYARQDAQCIDCFQAFLPVHYRYHRPHKKDGDTLIVVNNPDLLM 169

  Fly   123 NCPMADSAL---IENELVARPDKLYCLNAPESRFDENHIKDGQPTTMANLERCNWRRVHVDCQLK 184
            .|......|   .::|:.|                        |..:.:.|.|.|:.:.....||
Mouse   170 YCDQEFPILKCWAQSEVAA------------------------PCALKSEEICQWKSMQYKSILK 210

  Fly   185 MPLRAEIPVG---HASAYGPV------LCGTILLGWSLALWTIIH 220
             .|..::|||   |.|....|      ||.|::|   ||::...|
Mouse   211 -NLTVQVPVGLTIHTSLVCSVTLLITILCSTLIL---LAVFKYGH 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-XNP_001286172.1 PIG-X 3..218 CDD:285514 53/236 (22%)
PigxNP_077784.2 PIG-X 50..246 CDD:285514 52/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CY9W
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006600
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106418
Panther 1 1.100 - - LDO PTHR28650
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R890
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.