DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-X and pigx

DIOPT Version :9

Sequence 1:NP_001286172.1 Gene:PIG-X / 246580 FlyBaseID:FBgn0050381 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001004985.1 Gene:pigx / 448438 XenbaseID:XB-GENE-6455757 Length:236 Species:Xenopus tropicalis


Alignment Length:192 Identity:40/192 - (20%)
Similarity:72/192 - (37%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KDCEYALVQDLPASVYISTDELDDLQ--RLKRLNAIYPKFVNIEVATERAQPFSVLLRGTPKITE 91
            |.|...:.:.:|:.:|:...:|..|:  .|..:..:.|..|.......|.....|..:..|....
 Frog    54 KHCRVLIQEHIPSGLYLDPYQLSSLRHHNLTEVLLLTPVDVEAPEYLSRGHTALVYTKPDPSCAH 118

  Fly    92 --SLALPVHFRYHAPSDKRLAATVAIPLPELYLNCPMADSALIENELVARPDKLYCLNAPESRFD 154
              :..:|:|.|||.|:.:....::.:..|:|.|||..                    :.|.:...
 Frog   119 CYTSTVPLHIRYHRPASQTDKVSITLQNPKLLLNCGQ--------------------DFPPTSCS 163

  Fly   155 ENHIKDGQPTTMANLERCNWRRVHVDCQLKMP-------LRAEIPVGHASAYGPVLCGTILL 209
            .:.:.:. |..:.:.|.|.|        |.:|       |..|:|||.|.. ||::|...|:
 Frog   164 PHSVTEA-PCDLKDKELCQW--------LDLPYTADPNALNLEVPVGLAED-GPIVCAVTLI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-XNP_001286172.1 PIG-X 3..218 CDD:285514 40/192 (21%)
pigxNP_001004985.1 PIG-X 32..231 CDD:197872 40/192 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537024at2759
OrthoFinder 1 1.000 - - FOG0006600
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.