DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-X and Pigx

DIOPT Version :9

Sequence 1:NP_001286172.1 Gene:PIG-X / 246580 FlyBaseID:FBgn0050381 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001094121.1 Gene:Pigx / 288041 RGDID:1307289 Length:252 Species:Rattus norvegicus


Alignment Length:240 Identity:53/240 - (22%)
Similarity:93/240 - (38%) Gaps:60/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAGMHSDKCLCRTLNYRLRF-----DIPLVGKDCEYALVQDLPASVYISTDELDDLQRLKRLNAI 62
            |.|.|.|      |..:::|     |:    :.|...:...:|..:::...||..|:......|:
  Rat    48 KDGFHRD------LLIKVKFGESIEDL----QTCRLLIKHYIPTGLFVDPYELASLRERNITEAV 102

  Fly    63 -YPKFVNIEVATERAQPFSVLL--RGTPKITESLA--LPVHFRYHAPSDKRLAATVAIPLPELYL 122
             ..:..|:|..:..:...:||:  |...:..:...  ||||:|||.|..|.....:.:..|:|.:
  Rat   103 MVSESFNLEAPSYLSTESAVLIYARQDAQCIDCFQAFLPVHYRYHRPHKKDGDTLIVVNNPDLLM 167

  Fly   123 NCPMADSAL---IENELVARPDKLYCLNAPESRFDENHIKDGQPTTMANLERCNWRRVHVDCQLK 184
            :|......|   .::|:.|                        |.::.:.|.|.|:.:.....||
  Rat   168 HCDQEFPILKCWAQSEVAA------------------------PCSLKSEEICQWKNMQYKSILK 208

  Fly   185 MPLRAEIPVG---HASAYG------PVLCGTILLGWSLALWTIIH 220
             .|..::|||   |.|...      .|||.|::|   ||::...|
  Rat   209 -NLTVQVPVGLTIHTSLVCSVTLLITVLCSTLIL---LAVFKYGH 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-XNP_001286172.1 PIG-X 3..218 CDD:285514 52/236 (22%)
PigxNP_001094121.1 PIG-X 48..244 CDD:285514 51/233 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339575
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CY9W
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537024at2759
OrthoFinder 1 1.000 - - FOG0006600
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106418
Panther 1 1.100 - - LDO PTHR28650
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.