DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30378 and Myl9

DIOPT Version :10

Sequence 1:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_742116.1 Gene:Myl9 / 98932 MGIID:2138915 Length:172 Species:Mus musculus


Alignment Length:143 Identity:38/143 - (26%)
Similarity:84/143 - (58%) Gaps:8/143 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EAQIEEIREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYDLANESNADFGGQVQFKDFLY 71
            ::||:|.:|||::.|:.|.|::..:.|..::.:||::.|:..:..:.||:    .|.:.|..||.
Mouse    28 QSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMNEA----PGPINFTMFLT 88

  Fly    72 VMSKRLEEQNSLVCLKQAFKIFDRSEVNSFTINE--IRMVMTNLGEKMSEEDLRELFQDIDQDKD 134
            :..::|...:....::.||..|| .|.:.| |:|  :|.::|.:|::.::|::.|::::...||.
Mouse    89 MFGEKLNGTDPEDVIRNAFACFD-EEASGF-IHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKK 151

  Fly   135 GKISFNEFVTAMR 147
            |..::.||...::
Mouse   152 GNFNYVEFTRILK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 38/143 (27%)
Myl9NP_742116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PTZ00184 25..163 CDD:185504 38/140 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.