DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30378 and UNE14

DIOPT Version :10

Sequence 1:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_193022.1 Gene:UNE14 / 826898 AraportID:AT4G12860 Length:152 Species:Arabidopsis thaliana


Alignment Length:138 Identity:35/138 - (25%)
Similarity:73/138 - (52%) Gaps:2/138 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EIREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYDLANESNADFGGQVQFKDFLYVMSKR 76
            |:...|.::||...|.::..:|....:::|..:.|.||.::..:.:.:..|.:...:|..:..:.
plant     5 ELSRVFQMFDKNGDGKIAKNELKDFFKSVGIMVPENEINEMIAKMDVNGDGAMDIDEFGSLYQEM 69

  Fly    77 LEEQNSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSE--EDLRELFQDIDQDKDGKISF 139
            :||:.....:::||::||::.....|..|:|.|:.::|.|...  ||.:::...:|.|.||.::|
plant    70 VEEKEEEEDMREAFRVFDQNGDGFITDEELRSVLASMGLKQGRTLEDCKKMISKVDVDGDGMVNF 134

  Fly   140 NEFVTAMR 147
            .||...||
plant   135 KEFKQMMR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 35/138 (25%)
UNE14NP_193022.1 PTZ00184 5..141 CDD:185504 33/135 (24%)

Return to query results.
Submit another query.