DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30378 and MYL3

DIOPT Version :10

Sequence 1:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_000249.1 Gene:MYL3 / 4634 HGNCID:7584 Length:195 Species:Homo sapiens


Alignment Length:152 Identity:41/152 - (26%)
Similarity:79/152 - (51%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TEAQIEEIREAFSLYDKERSGWVSVQ--QLGGVMRALGESLTEAEIYDL-----ANESNADFGGQ 63
            |..||||.:|||.|:|:.....:.:.  |.|.|:||||::.|:||:..:     ..|.|..   .
Human    47 TPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTK---M 108

  Fly    64 VQFKDFLYVMS--KRLEEQNSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELF 126
            :.|:.||.::.  .:.::..:.....:..::||:....:....|:|.|:..|||:::|:::.:|.
Human   109 MDFETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLM 173

  Fly   127 QDIDQDKDGKISFNEFVTAMRS 148
            .. .:|.:|.|::..||..:.|
Human   174 AG-QEDSNGCINYEAFVKHIMS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 40/150 (27%)
MYL3NP_000249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
PTZ00184 44..194 CDD:185504 40/150 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.