DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30378 and MYL1

DIOPT Version :10

Sequence 1:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_524144.1 Gene:MYL1 / 4632 HGNCID:7582 Length:194 Species:Homo sapiens


Alignment Length:147 Identity:45/147 - (30%)
Similarity:81/147 - (55%) Gaps:5/147 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TEAQIEEIREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYD-LANESNADFGG-QVQFKD 68
            ::.|.:|.:|||.|:|:.....:::.|:|.|:||||.:.|.||:.. |.|.||.:... :::|:.
Human    48 SKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQ 112

  Fly    69 FLYVMS--KRLEEQNSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELFQDIDQ 131
            ||.:|.  ...::|.:.....:..::||:....:....|:|.|:..|||||.||::..|... .:
Human   113 FLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAG-QE 176

  Fly   132 DKDGKISFNEFVTAMRS 148
            |.:|.|::..||..:.|
Human   177 DSNGCINYEAFVKHIMS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 44/145 (30%)
MYL1NP_524144.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
PTZ00184 45..193 CDD:185504 44/145 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.