DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30378 and Myl3

DIOPT Version :10

Sequence 1:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_034989.1 Gene:Myl3 / 17897 MGIID:97268 Length:204 Species:Mus musculus


Alignment Length:147 Identity:41/147 - (27%)
Similarity:79/147 - (53%) Gaps:13/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TEAQIEEIREAFSLYDKERSGWVSVQ--QLGGVMRALGESLTEAEIYDL-----ANESNADFGGQ 63
            |..||||.:|||.|:|:...|.:.:.  |.|.|:||||::.|:||:..:     ..|.|:.   .
Mouse    56 TPEQIEEFKEAFLLFDRTPKGEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSK---M 117

  Fly    64 VQFKDFLYVMS--KRLEEQNSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELF 126
            :.|:.||.::.  .:.::..:.....:..::||:....:....|:|.|:..|||:::|:::.:|.
Mouse   118 MDFETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLM 182

  Fly   127 QDIDQDKDGKISFNEFV 143
            .. .:|.:|.|::..||
Mouse   183 AG-QEDSNGCINYEAFV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 41/147 (28%)
Myl3NP_034989.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
PTZ00184 53..203 CDD:185504 41/147 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.