DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30378 and MYL6B

DIOPT Version :10

Sequence 1:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_002466.1 Gene:MYL6B / 140465 HGNCID:29823 Length:208 Species:Homo sapiens


Alignment Length:139 Identity:44/139 - (31%)
Similarity:75/139 - (53%) Gaps:5/139 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QIEEIREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYDLANESNAD--FGGQVQFKDFLY 71
            |:||.:|||.|:|:...|.:...|.|.||||||::.|.||:..:.....:|  ...:|.|:.||.
Human    65 QLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLP 129

  Fly    72 VMS--KRLEEQNSLVCLKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELFQDIDQDKD 134
            ::.  .:...|.:.....:.|::||:.........|:|.|:|.|||||:||::..:... .:|.:
Human   130 MLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAG-HEDSN 193

  Fly   135 GKISFNEFV 143
            |.|::..|:
Human   194 GCINYEAFL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 44/139 (32%)
MYL6BNP_002466.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
PTZ00184 58..207 CDD:185504 44/139 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.