DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30375 and CG34290

DIOPT Version :9

Sequence 1:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:277 Identity:77/277 - (27%)
Similarity:122/277 - (44%) Gaps:49/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 NCQAVARPAPCDCGWSFPNRIANGVEAGKHEFPSMVGLRDLSS-------NLPIFCGGSIVSERY 189
            :|.||    |...|     ||.:.|.:...::|.||.|:|:.:       :...|||||::|:|:
  Fly    28 SCHAV----PIVGG-----RIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRW 83

  Fly   190 IMTAAHCTARQPVASRLLALVGEHDLST-------GAESIYAAQYRIQNIINHPGYMETASGNIN 247
            |::||||..|:.: ..:.|.:|..::..       |.||:....::..|.             .|
  Fly    84 ILSAAHCVWRKNI-HYIAAFIGYENIENIGQLQPYGLESVEYIYFQPSNF-------------RN 134

  Fly   248 DIALLQTATPIEWS---RGVAPICLPIRQAENSFNYQNVDIMGWGTLGFAASKSNTLQKATLLTM 309
            |||||...... ||   .|:....||....:...| ::..|:|:|....|......|.:|.:..:
  Fly   135 DIALLYMKRRY-WSDFGNGLQYAQLPPHGMKPDQN-ESCRIIGYGATHHAGPCQKRLFEAEVRVI 197

  Fly   310 DNAVCRSRFNSSITPSH----LCTYDAGGRGQDSCQYDSGGPVILRQRERMFQLGVISYGRACGQ 370
            ||..||........|.:    :|   |.|..|||||.|||||:|.....:.:..|::|:|..||.
  Fly   198 DNQKCRDIIGHIWAPQNGANTVC---ALGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGI 259

  Fly   371 PFGIGVNTRVTSHLNWL 387
            |....:.|....:.:|:
  Fly   260 PGMPSIYTVTRPYYDWV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 71/255 (28%)
Tryp_SPc 152..387 CDD:238113 70/255 (27%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 73/267 (27%)
Tryp_SPc 34..276 CDD:214473 72/265 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.