DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30375 and CG12951

DIOPT Version :9

Sequence 1:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:245 Identity:79/245 - (32%)
Similarity:125/245 - (51%) Gaps:22/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 NRIANGVEAGKHEFPSMVGLRDLSSNLPIFCGGSIVSERYIMTAAHCTARQPVASRLLALVGEHD 214
            :|:.||.::...::|.:|.||....:..  |||||:|:.::|||||||..:| |..|....|..:
  Fly    28 SRVVNGTDSSVLKYPFVVSLRSYDGSHS--CGGSIISKHFVMTAAHCTNGRP-ADTLSIQFGVTN 89

  Fly   215 LSTGAESIYAAQYRIQNIINHPGYMETASGNINDIALLQTATPIEWSR-GVAPICLP---IRQAE 275
            :|....::..    |:.||.|..:..|.. |.|||:||....|.|:.. .|||:.||   ....:
  Fly    90 ISAMGPNVVG----IKKIIQHEDFDPTRQ-NANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQ 149

  Fly   276 NSFNYQNVDIMGWGTLGFAASKSNTLQKATLLTMDNAVCRSRFNSSITPS-HLC-TYDAGGRGQD 338
            :....:.| ::|||......|..:|||:.:|....:..|.||.|....|. |:| ..|.||:|| 
  Fly   150 SDAGVEGV-LIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQ- 212

  Fly   339 SCQYDSGGPVILRQRERMFQLGVISYG-RACGQPFGIGVNTRVTSHLNWL 387
             |..|||||:|...:    |:|::|:. :.|......||..:|:.:::|:
  Fly   213 -CSGDSGGPLIYNGQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 78/241 (32%)
Tryp_SPc 152..387 CDD:238113 77/241 (32%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/242 (32%)
Tryp_SPc 30..260 CDD:238113 78/243 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.