DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30375 and CG14642

DIOPT Version :9

Sequence 1:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster


Alignment Length:269 Identity:82/269 - (30%)
Similarity:124/269 - (46%) Gaps:40/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 FPNRIANGVEAG-----------KHEFPSM--VGLRDLSSNLPIFCGGSIVSERYIMTAAHCTAR 199
            |||..|...:|.           ..|:|.|  ||.......:...||||::|||:::||||||:.
  Fly   129 FPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSI 193

  Fly   200 QPVASRLLALVGEHDLSTGAESIYAAQYRIQNIINHPGYMETASGNINDIALLQTATPIEWSRGV 264
            .....:.:. :|:.||::...|:.|...||:.:..||.|.:..  ..:|||||:....:|.:..|
  Fly   194 YEAPPKWVR-IGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKM--YYDDIALLKLEKEVELTEYV 255

  Fly   265 APICL---PIRQAENSFNYQNVDIMGWGTLGFAASKSNTLQKATLLTMDNAVCRSRF------NS 320
            .|:.|   |......:|      .||:|...||...:|.|....|..:.||.|.:..      .|
  Fly   256 RPVRLWVFPELPTTIAF------AMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPS 314

  Fly   321 SITPSHLCTYDAGGRGQDSCQYDSGGPVIL-----RQRERMFQ--LGVISYGRACGQPFGIGVNT 378
            .:..|.:|..|. ...:|:||.|||||:.|     |:..|:..  :|:.|||..|...:. .|.|
  Fly   315 GVLESQICAQDY-ILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCRSSYP-SVYT 377

  Fly   379 RVTSHLNWL 387
            ||:|.|:|:
  Fly   378 RVSSFLDWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 78/263 (30%)
Tryp_SPc 152..387 CDD:238113 78/263 (30%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/252 (31%)
Tryp_SPc 146..386 CDD:214473 76/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.