DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30375 and CG13527

DIOPT Version :9

Sequence 1:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:231 Identity:60/231 - (25%)
Similarity:98/231 - (42%) Gaps:50/231 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 FCGGSIVSERYIMTAAHCTARQP----VASRLLALVGE-HDLS-TGAESI---YAAQYRIQNIIN 234
            :|||.::|.::::|||||...|.    .|..||.:.|. |.|. |..:|:   .::.|..:|...
  Fly    61 YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTM 125

  Fly   235 HPGYMETASGNINDIAL--LQTATPIEWSRGVAPICLPIRQAENSFNYQNVDIMGWGTLGFAASK 297
            |         |..::||  ||...|....| :..:.||....:....:   .::|||.:.|....
  Fly   126 H---------NTFNMALMKLQEKMPSNDPR-IGFLHLPKEAPKIGIRH---TVLGWGRMYFGGPL 177

  Fly   298 SNTLQKATLLTMDNAVCRSRFNSSITPSH-----LC------TYDAGGRGQDSCQYDSGGPVILR 351
            :..:.:..::.||||||::.|.      |     :|      |.||     :.|..|.|.|::  
  Fly   178 AVHIYQVDVVLMDNAVCKTYFR------HYGDGMMCAGNNNWTIDA-----EPCSGDIGSPLL-- 229

  Fly   352 QRERMFQLGVISYGRACGQPFGIGVNTRVTSHLNWL 387
              .....:|:::|...||......|.|.|.|.|.|:
  Fly   230 --SGKVVVGIVAYPIGCGCTNIPSVYTDVFSGLRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 59/228 (26%)
Tryp_SPc 152..387 CDD:238113 59/229 (26%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 60/231 (26%)
Tryp_SPc 43..263 CDD:214473 59/229 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456005
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.