DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30375 and CG4927

DIOPT Version :9

Sequence 1:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:371 Identity:103/371 - (27%)
Similarity:149/371 - (40%) Gaps:84/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CRFELFPDTCGSEFLFISRDGDLQFRDGERYCRMGQVNRISNFQTMAFAYYSSSPQTQQRS---- 129
            |: ||....|.|.|..:.     ..|:..:||..      ||.........:..||:||.|    
  Fly    29 CK-ELSATDCPSIFFNLH-----LIRNFVKYCDK------SNHIVCCLLPNNMQPQSQQFSANIG 81

  Fly   130 --------------RLNCQAVARPAPCDCGWSFPNRIANGVEAGKHEFP--SMVGLRDL-SSNLP 177
                          |.:|    |..|.         |..|.:|...|||  :::|.|.. ||.:.
  Fly    82 LRRFEKECRRFNEIRTSC----RTTPF---------IVGGAKAAGREFPFMALLGQRGKNSSQID 133

  Fly   178 IFCGGSIVSERYIMTAAHC-----TARQPV-----ASRLLALVGEHDLSTGAESIYAAQYRIQNI 232
            ..||..|:..::::|||||     |..|.:     ..:.:..:||.|.::..:......:|:.|.
  Fly   134 WDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNY 198

  Fly   233 INHPGYME---TASGNINDIALLQTATPIEWSRGVAPICLPIRQAENSFNYQ-NVDIMGWGTLGF 293
            :.||.|.|   |.|.. ||||:::......:|..|||.|||:    :..|.| .|...|||....
  Fly   199 VVHPAYGEDDDTGSRK-NDIAVVELEMEATFSEYVAPACLPL----DGGNEQLQVAAAGWGATSE 258

  Fly   294 AASKSNTLQKATLLTMDNAVCRSRFNSSI-TPSHLCTYDAGGR--GQDSCQYDSGGPVI------ 349
            :...|:.|.|.:|...|.|.|..|....| ..:.||   ||.|  ..|:|..||||||.      
  Fly   259 SGHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQLC---AGSRSTSADTCYGDSGGPVFVQHPIY 320

  Fly   350 --LRQRERMFQLGVISYGRACGQPFGIGVNTRVTSHLNWLWRYIGG 393
              |:|     .:|:.|||..||......|.|:|..:.:|:...:.|
  Fly   321 SCLKQ-----VIGITSYGLVCGVQGLPSVYTKVHLYTDWIENIVWG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30375NP_724665.1 CUB 38..>100 CDD:294042 7/30 (23%)
Tryp_SPc 151..386 CDD:214473 81/262 (31%)
Tryp_SPc 152..387 CDD:238113 81/262 (31%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 82/265 (31%)
Tryp_SPc 105..355 CDD:214473 81/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455981
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.