DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30375 and TMPRSS7

DIOPT Version :9

Sequence 1:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:400 Identity:93/400 - (23%)
Similarity:155/400 - (38%) Gaps:113/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FDLIPNRTINITSFNYPGAI--------PSG---SNCRFRLKAPSNHVIYLSCRFELFPDTCGSE 81
            |.:.|....|.:||...|.:        .:|   .||...:  |.|:..:          .||::
Human   517 FCVSPQPACNTSSFRQHGPLICDGFRDCENGRDEQNCTQSI--PCNNRTF----------KCGND 569

  Fly    82 FLFISR----DGDLQFRDG--ERYCRMGQVNRISNFQTMAFAYYSSSPQTQQRSRLNCQAVARPA 140
            ..|..:    ||.:...||  |..|                                        
Human   570 ICFRKQNAKCDGTVDCPDGSDEEGC---------------------------------------- 594

  Fly   141 PCDCGWSFPNRIANGVEAGKHEFPSMVGLRDLSSNLPIFCGGSIVSERYIMTAAHC------TAR 199
            .|....|..:||..|.:..:..:|..|.|..:.|   .:||.|::|..::::||||      :..
Human   595 TCSRSSSALHRIIGGTDTLEGGWPWQVSLHFVGS---AYCGASVISREWLLSAAHCFHGNRLSDP 656

  Fly   200 QPVASRL-LALVGEHDLSTGAESIYAAQYRIQNIINHPGYMETASGNINDIALLQTATPIEW--- 260
            .|..:.| :.:.|.....:....|...:|......::            ||||||.:  |.|   
Human   657 TPWTAHLGMYVQGNAKFVSPVRRIVVHEYYNSQTFDY------------DIALLQLS--IAWPET 707

  Fly   261 -SRGVAPICLP-----IRQAENSFNYQNVDIMGWGTLGFAASK-SNTLQKATLLTMDNAVCRSRF 318
             .:.:.|||:|     :|..|..:      :.|||....|.:| |..||:|.:..:|..:|.|.:
Human   708 LKQLIQPICIPPTGQRVRSGEKCW------VTGWGRRHEADNKGSLVLQQAEVELIDQTLCVSTY 766

  Fly   319 NSSITPSHLCTYDAGGRGQDSCQYDSGGPVILRQRE--RMFQLGVISYGRACGQPFGIGVNTRVT 381
             ..||...||.....|: :|:|:.|||||:..|::.  :....|::|:|...|:|...||.|||:
Human   767 -GIITSRMLCAGIMSGK-RDACKGDSGGPLSCRRKSDGKWILTGIVSWGHGSGRPNFPGVYTRVS 829

  Fly   382 SHLNWLWRYI 391
            :.:.|:.:|:
Human   830 NFVPWIHKYV 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30375NP_724665.1 CUB 38..>100 CDD:294042 16/78 (21%)
Tryp_SPc 151..386 CDD:214473 69/253 (27%)
Tryp_SPc 152..387 CDD:238113 68/253 (27%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I4403
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.