DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30375 and gd

DIOPT Version :9

Sequence 1:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:391 Identity:80/391 - (20%)
Similarity:142/391 - (36%) Gaps:83/391 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KAPSN-HVIYLSCRFELFP-DTCGSEFLFISRDGD--LQFRDGERYCRMGQVNRISNFQTMAFAY 118
            |.||. |:.:....|...| :.||.    |.||.|  |..|....:..:|:........:..|. 
  Fly   166 KPPSTPHIQFKKKPFAQAPKEICGR----IDRDLDFHLSQRTESLHVAIGEPKSSDGITSPVFV- 225

  Fly   119 YSSSPQTQQRSRLNCQAV----ARPAPCDCGWSFPNRIANGVEAGKHEFPSMVGLRDLSSNLPIF 179
                 ...:...|..|.|    |.....|...|.|:     :..|...:.:.:.:.:|:| |...
  Fly   226 -----DDDEDDVLEHQFVDESEAEAIESDSADSLPS-----ITRGSWPWLAAIYVNNLTS-LDFQ 279

  Fly   180 CGGSIVSERYIMTAAHCTA---RQPVASRLLALVGEHDLST-GAESIYAAQYRIQNIINHPGYME 240
            ||||:||.|.::::|||..   ::..::.:|..:|.|:|.. ..|...||.  :..|..||.:..
  Fly   280 CGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKNWNEEGSLAAP--VDGIYIHPDFNS 342

  Fly   241 TASGNINDIALLQTATPIEWSRGVAPICLPIRQAENSFNY-QNVDIMGW---------------- 288
            ..|....|||::.....:.::..:.|.||....::..:.. :...::||                
  Fly   343 QLSSYDADIAVIILKDEVRFNTFIRPACLWSGSSKTEYIVGERGIVIGWSFDRTNRTRDQKLSSE 407

  Fly   289 --GTLGFAASKSNTLQKATLLTMDNAVC---RSRFNSSITPSHLCTYDAGGRGQDSCQYDSGGPV 348
              |.....||....: ||.:  :.||.|   .:.|.|..:....|   ||.:.::...:.||..:
  Fly   408 LPGKKSTDASAPKVV-KAPI--VGNAECFRANAHFRSLSSNRTFC---AGIQAEERDTHQSGASI 466

  Fly   349 ---------ILRQRERMFQLGVI--------------SYGRACGQPFGIGVNTRVTSHLNWLWRY 390
                     .:|:..|....|.:              |:...|...:.|..:  |...|:|:..:
  Fly   467 YTGISGAGLFIRRNNRWMLRGTVSAALPAVETPDAESSHKLCCKNQYIIYAD--VAKFLDWITAF 529

  Fly   391 I 391
            :
  Fly   530 V 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30375NP_724665.1 CUB 38..>100 CDD:294042 14/45 (31%)
Tryp_SPc 151..386 CDD:214473 56/283 (20%)
Tryp_SPc 152..387 CDD:238113 56/283 (20%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 56/279 (20%)
Tryp_SPc 258..526 CDD:214473 56/278 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.