DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30375 and CG1632

DIOPT Version :9

Sequence 1:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster


Alignment Length:382 Identity:75/382 - (19%)
Similarity:122/382 - (31%) Gaps:176/382 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 SFPNRIANGVEAGKHEFPSMVGL--RDLSSNLPIFCGGSIVSERYIMTAAHCTARQPVASRLLAL 209
            |.|...|.|      ::|.:|.|  .|:.     .|.|:::::.:::|...|...||.|: .:|:
  Fly   703 SLPKMSAPG------DWPWLVALFREDIH-----VCDGTLITQDWVLTTEGCFQGQPRAT-WMAI 755

  Fly   210 VGEHDLSTGAESIYAAQYRIQNIINHPGYMETASGNINDIALLQTATPIEWSRGVAPICLP---- 270
            ||...||  |::.:..:.||..:|..|....||       ||::..||:.:|..|.|||||    
  Fly   756 VGAVRLS--AKAPWTQRRRIIGMIKSPVEGSTA-------ALVRLETPVSYSDHVRPICLPDALQ 811

  Fly   271 -------------------------IRQAENSFNYQN---------------------------V 283
                                     :.|..:..:.:|                           .
  Fly   812 RRLLQQPPAQRRSHVPVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQE 876

  Fly   284 DIMG------------------------------------------------------------- 287
            |..|                                                             
  Fly   877 DHFGGESAASYMPKAEALHQELDGYPLPDHAPQVNYYSSSSTVTSSSTAARIATKAPILAAVPAA 941

  Fly   288 ----W---GTLGFAASKSNTLQKATLLTMDNAVCRSRFNSSI-TPSHLC---TYDAGGRGQDSCQ 341
                |   .|||::..:.: ||:..|...|.|.|.   |.|| |.:.:|   ||.         :
  Fly   942 QEQIWTNCNTLGWSRQRDH-LQRVQLKMGDMAPCE---NVSIATVNSMCMEATYQ---------K 993

  Fly   342 YD------SGGPV--ILRQRERMFQLGVISYGRACGQPFGI---GVNTRVTSHLNWL 387
            ||      ||.||  ::....:...:||.|:..||| |.|:   .:..::.|:..|:
  Fly   994 YDCTQEEYSGAPVQCLIPGTNQWALIGVSSWRIACG-PTGVERPRMYDKIASNAAWI 1049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 72/375 (19%)
Tryp_SPc 152..387 CDD:238113 72/375 (19%)
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450 36/121 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.