DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30375 and St14

DIOPT Version :9

Sequence 1:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:512 Identity:119/512 - (23%)
Similarity:186/512 - (36%) Gaps:175/512 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YPGAIPSGSNCRFRLKAPSNHVIYLSCRFELF----PDT-----------------CG--SEF-- 82
            |||..|...||.:.:|.|:|..:  ..||:||    |:.                 ||  |:|  
  Rat   356 YPGHYPPNINCTWNIKVPNNRNV--KVRFKLFYLVDPNIPVGSCTKDYVEINGEKFCGERSQFVV 418

  Fly    83 -------------------------------------LFISRDG-----DLQFRDG--------- 96
                                                 :|:.:.|     ||:. ||         
  Rat   419 SSNSSKITVHFHSDHSYTDTGFLAEYLSYDSNDPCPGMFMCKTGRCIRKDLRC-DGWADCPDYSD 482

  Fly    97 ERYCRMGQVNRI---SNFQTMAF-----------------------AYYSSS----PQTQQ---- 127
            ||:||....::.   :.|....|                       ::..|:    ||:||    
  Rat   483 ERHCRCNATHQFMCKNQFCKPLFWVCDSVNDCGDGSDEEGCSCPAGSFKCSNGKCLPQSQQCNGK 547

  Fly   128 ----------------------------------------RSRLNCQAVARPAPCDCGW-SFPN- 150
                                                    ..:.:|...:....||||. ||.. 
  Rat   548 DDCGDGSDEASCDNVNAVSCTKYTYRCQNGLCLNKGNPECDGKKDCSDGSDEKNCDCGLRSFTKQ 612

  Fly   151 -RIANGVEAGKHEFPSMVGLRDLSSNLPIFCGGSIVSERYIMTAAHCTARQPV-----ASRLLAL 209
             |:..|..|.:.|:|..|.|..|...  ..||.|::|..::::||||...:.:     .:...|.
  Rat   613 ARVVGGTNADEGEWPWQVSLHALGQG--HLCGASLISPDWLVSAAHCFQDETIFKYSDHTMWTAF 675

  Fly   210 VGEHDLSTGAESIYAAQYRIQNIINHPGYMETASGNINDIALLQTATPIEWSRGVAPICLPIRQA 274
            :|..|.|..:.| ...:::::.||.||.:.:....  .|||||:...|.|:|..|.|||||    
  Rat   676 LGLLDQSKRSAS-GVQEHKLKRIITHPSFNDFTFD--YDIALLELEKPAEYSTVVRPICLP---- 733

  Fly   275 ENSFNY---QNVDIMGWGTLGFAASKSNTLQKATLLTMDNAVCRSRFNSSITPSHLCTYDAGGRG 336
            :|:..:   :.:.:.|||......:.:..|||..:..::...|.......|||..:|.....| |
  Rat   734 DNTHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEELLPQQITPRMMCVGFLSG-G 797

  Fly   337 QDSCQYDSGGPVILRQRE-RMFQLGVISYGRACGQPFGIGVNTRVTSHLNWLWRYIG 392
            .||||.|||||:...::: |:||.||:|:|..|.|....||.||:....:|:....|
  Rat   798 VDSCQGDSGGPLSSVEKDGRIFQAGVVSWGEGCAQRNKPGVYTRIPEVRDWIKEQTG 854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30375NP_724665.1 CUB 38..>100 CDD:294042 26/132 (20%)
Tryp_SPc 151..386 CDD:214473 75/243 (31%)
Tryp_SPc 152..387 CDD:238113 74/243 (30%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001 18/89 (20%)
LDLa 454..486 CDD:238060 8/32 (25%)
LDLa 492..523 CDD:238060 2/30 (7%)
LDLa 525..559 CDD:238060 5/33 (15%)
LDLa 567..602 CDD:238060 1/34 (3%)
Tryp_SPc 615..852 CDD:238113 75/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4333
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.