DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30369 and CG14759

DIOPT Version :10

Sequence 1:NP_724661.1 Gene:CG30369 / 246572 FlyBaseID:FBgn0050369 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_610367.1 Gene:CG14759 / 35803 FlyBaseID:FBgn0033278 Length:126 Species:Drosophila melanogaster


Alignment Length:74 Identity:29/74 - (39%)
Similarity:35/74 - (47%) Gaps:11/74 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MSFGRVLGGLSVLHFSRNRSLHQRRT---------RRPFPVVPDARIKTPAQSTRPPRILVKSFL 57
            |..||:|.|..:  |.....|.|||.         |||.||....|..:.....|||.:||||||
  Fly     1 MFTGRLLIGSPI--FEAKMRLQQRRRMSEHRLPYHRRPAPVKLQDRKSSWTDLKRPPFLLVKSFL 63

  Fly    58 ALHHLDSVY 66
            .|.|:|:.|
  Fly    64 NLRHMDADY 72

Return to query results.
Submit another query.