DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment swif and CG12861

DIOPT Version :9

Sequence 1:NP_001097231.1 Gene:swif / 246569 FlyBaseID:FBgn0050366 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_610978.2 Gene:CG12861 / 36628 FlyBaseID:FBgn0033953 Length:239 Species:Drosophila melanogaster


Alignment Length:259 Identity:64/259 - (24%)
Similarity:94/259 - (36%) Gaps:88/259 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HHVPSGRCVQARETINLKLPHERLLKQERDQKKERKCCVLRSAAKN------PCVEIRRPKAAKL 104
            |.:.|....:..:|:.......|.|:..::.|:..:.| .::|::|      |.:.:  ||...:
  Fly    15 HSLGSLTIKRTYDTVKKMNLRRRRLEHLKELKRLDEMC-YKAASRNDKKCHPPVLPL--PKMECI 76

  Fly   105 EEKPFRSMWEPPCKANEQPFCKEMLPRFDAMYYHPSNK-CRCYQRTWVECSPVKKRLKKV--CCL 166
            ::         ||..:|.|        .|..:|.||:| .|.|||||.||..:.|...|.  |  
  Fly    77 DD---------PCAESEMP--------LDLDHYTPSDKAARKYQRTWCECYMIPKAAVKARKC-- 122

  Fly   167 DAIEPPEILYRIRP----PCPGTCQINYKARRLLCAD--------------GEWERDPTRKCPKF 213
                     |..||    .||....:..:...:.|.|              |:|           
  Fly   123 ---------YPNRPRRKFECPRVSDVECRWDPMPCDDVKKKPEILIEVPRIGKW----------- 167

  Fly   214 FHPCCKL-------ARCNPRCSRGRKPTLCTKLRAPYPCYSEKIRGTRPLRKRECLCLETTPKC 270
              ||||:       .|..|.|..||.||.|.|.|..||.:||        .|:|  .|:..|.|
  Fly   168 --PCCKIPTPGCRDGRIPPSCDAGRIPTCCKKRRTKYPSFSE--------CKKE--LLDPIPPC 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
swifNP_001097231.1 DUF1431 121..278 CDD:284625 50/178 (28%)
CG12861NP_610978.2 DM6 74..235 CDD:214775 52/197 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.